PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010905801.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 282aa    MW: 32016.9 Da    PI: 5.8819
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010905801.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31.1e-51101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL+kkv+++k++   ++ ev++++ ePw+Lp+ +k + +ewyfFs rd+kyatg+r+nratksgyWkatgkd+++++ 
  XP_010905801.1  10 LPPGFRFYPSDEELVCHYLHKKVANEKVSG-GTLVEVNLHTREPWELPEVAKLSANEWYFFSFRDRKYATGSRTNRATKSGYWKATGKDRTIYEP 103
                     79*************************999.88***************88888999**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++ vg++ktLvfy+grap+g kt Wvmhe+rle
  XP_010905801.1 104 aTHAIVGMRKTLVFYRGRAPNGIKTGWVMHEFRLE 138
                     67778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-607156IPR003441NAC domain
PROSITE profilePS5100558.30610156IPR003441NAC domain
PfamPF023652.2E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDLRDIESTL PPGFRFYPSD EELVCHYLHK KVANEKVSGG TLVEVNLHTR EPWELPEVAK  60
LSANEWYFFS FRDRKYATGS RTNRATKSGY WKATGKDRTI YEPATHAIVG MRKTLVFYRG  120
RAPNGIKTGW VMHEFRLENL HAPPKEDWVL CRVFHKKKGD AVNHSLENND QDNNMGCFSS  180
VHLESSPLND HPMADGCYEQ MVPHQEGNSS NTFLNLAVLH YNFLDFPQET DSTTMTGVDS  240
RGGEDDFGLL LDVGIADHDL VEGGMANMGG MMFQRGTDQL FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-49515710169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010905801.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ23e-65NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0U5T81e-157M0U5T8_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP02760_0011e-156(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-81NAC domain containing protein 74